DPCstruct | MC22
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 122 ± 13 aa |
| Standard deviation of domain lengths | 13.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L7M9N7 | 4-102 | KIGFWCENIALTAGEDPFLLDTYLGPTPSSAVRWMWERARRSAPQLAPAPAEEVACWLAADGEHRRAVQVLEYGSVYLYGVLDDEVH… |
| A0A7X6HZ16 | 88-222 | PPTRLGPCGYWNESVARCPDAGGEWYLGSGWTATPADSLAWMRAEAERLARALSPRPGEGPAPSEALRPAAATSWDPAGVLRGWAAD… |
| A0A1H9PGV6 | 33-143 | None |
| A0A371Q7X1 | 7-118 | None |
| A0A2N0GW33 | 14-132 | None |
| F3ZBS3 | 6-115 | None |
| A0A1C4PT60 | 7-129 | None |
| A0A0M8SZ43 | 53-184 | None |
| A0A6B2UNB0 | 8-141 | None |
| A0A1C6PJI7 | 131-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.