DPCstruct | MC21999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 201 ± 34 aa |
| Standard deviation of domain lengths | 34.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0229- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286UV44 | 6-134 | THISTLEGFSGPKLSQSVHREECTQCFDNQDTEDGVDICLSCFNGGCNDEKRHHAYNHANKTGHTFTFNIKRRPKPTLSKREDSDEP… |
| A0A150FZV0 | 1-184 | MAAVDEAALARVRQYMRAVRMPSYHDKVYKDECMFSYDSPESPGGLYVNLATFQGFGEEYVGLDVQRSGGGLYLHLKHKRVPLPKAE… |
| A0A421JUL4 | 9-209 | None |
| A0A1I7S1W3 | 11-193 | None |
| A0A4R0RR84 | 1-218 | None |
| A0A2V2XDL0 | 15-204 | None |
| A0A367LCY3 | 574-777 | None |
| A0A0B1PQJ1 | 564-771 | None |
| A0A0R3Q7D0 | 13-193 | None |
| A0A0N5CQF6 | 2-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.