DPCstruct | MC21998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S3UPJ7 | 63-192 | WGFNGFFSRQNGGGFLTDHFPMAQKAIWDFKGMMTSSRHIPGVEFAGLIHPGLIGCLPDHKMLAEWNRREQELIDTDPGRVPPLANP… |
| A0A150FYM2 | 1-140 | MGTFDRDNGGGFLTDHFPEATKAIWYFDGIYASSRHIPGVRFAGLIHPGLIGTAPSHELLSIWNERESALVEGRGGSGLAGVLHTRP… |
| A0A812VNC3 | 130-250 | None |
| A0A438FBZ8 | 112-236 | None |
| W6QLH0 | 21-130 | None |
| R7WE26 | 434-571 | None |
| A0A3M6WGH4 | 313-443 | None |
| A0A1J8QR86 | 279-408 | None |
| H1UUZ0 | 9-139 | None |
| A0A317A0W5 | 109-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.