DPCstruct | MC21997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 304 ± 31 aa |
| Standard deviation of domain lengths | 30.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150FV15 | 23-327 | TLLLPPAPPEALTAQPPTVLSHVIGGSPAGVTLSGVRLVLPTETELTVYTRQLCDPQSWAFNVRRLEVLRGEVLFGNESMPLGWAPP… |
| A0A2K3D3T5 | 71-334 | KGRPDVLAMPQGTAVNLSCLTALNATVAAPSAAVGSVFLQPTALDLSAASGLSMAGVSLSTDCATVLAYQQYLCTSLRAAGSLTMEP… |
| A0A2J7ZRW9 | 259-575 | None |
| A0A0D2KWN7 | 15-376 | None |
| A0A150GLN5 | 3-267 | None |
| A0A150GLJ1 | 56-346 | None |
| A0A150GLD8 | 5-312 | None |
| A0A150GB84 | 12-343 | None |
| A0A2J8A3M5 | 168-414 | None |
| A0A150H2U6 | 45-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.