DPCstruct | MC21995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 141 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7ZTD4 | 3-132 | ARAFVEAADAGCMEVVEWLAARRCPMRGYIDQGDPYARAGGNGDLAMLACLLRLGCPWSPDGLTFEAALQAGCGLPVLRWLLGSGCS… |
| A0A150FTP8 | 15-140 | CFSDAAGSGCEEAVEWLMARGCPMEANGYAYTAACRNGDLAMARLLRRLGVPWGPAGDVVSRALHDSPLPMVRWLLEAGCPVGDYEA… |
| A0A835XQK7 | 73-223 | None |
| A0A2J8AGF1 | 385-524 | None |
| A0A835XZ16 | 759-877 | None |
| A8IXM6 | 275-409 | None |
| A0A836BXB9 | 111-276 | None |
| A0A835TCW7 | 953-1106 | None |
| A0A150FYU1 | 202-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.