DPCstruct | MC21993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3JVG9 | 1-97 | MKVYLKNIKQTTSYLYTENQYFRFPPLVREFIAHWETLKSGGRAEGSIHWFTVTNSSNEGIGKGTYTTNEMFKLLGKQDVMPGVARA… |
| A0A158IWJ9 | 4-118 | SEDAIDRAVRAQILRTQSQKGKRDIEKVYLQAANNVSNYIYVENQYFRFVPIAEKIKSAVAAQIKQGRSPDNPIYLFVITNSNDEGI… |
| A0A2X1REL8 | 1-97 | None |
| J9KLD4 | 80-184 | None |
| A0A4S2DRD2 | 1-96 | None |
| A0A833QFM2 | 249-350 | None |
| A0A336NHX5 | 10-133 | None |
| A0A4R1UUU0 | 342-442 | None |
| A0A496KVT7 | 478-600 | None |
| A0A4R2T7V2 | 26-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.