DPCstruct | MC2199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 343 ± 66 aa |
| Standard deviation of domain lengths | 66.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.76 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0286- PF20646 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0WHG8 | 20-367 | VTISKDTELPSSGSYSDSYNINEDATLAIADGTTVTGGTSASLSSNLDVDGNLCIGAESVTVTSSTITNNGNLVIYNGDSMTDGGTN… |
| X5ZPQ2 | 186-451 | GTMTIGDGALLPLSGIINNSGLISLDSAGGDTLLQVIQHGVTLQGGGQILLSDSAANIISGTGPDATLVNVDNTIAGAGQLGGGMLS… |
| G0VJ51 | 24-393 | None |
| H2B009 | 24-413 | None |
| A0A5M6IRC1 | 1-347 | None |
| A0A5M6J229 | 29-297 | None |
| A0A4V1TTN1 | 33-302 | None |
| A0A421JD66 | 13-381 | None |
| A7WPK1 | 15-473 | None |
| H2ARD8 | 21-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.