DPCstruct | MC21989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3MUP2 | 380-545 | LNVSVFKLLSWTIDEYRIAVREDDFFDSVERVLRDGKALGAAKTFYEDRVALVEKKFYVAGGSARMMFALTTTMAMDSLGKGLSAVD… |
| A0A7S0QDU5 | 10-174 | LSPWTKEDYLEAVTNKAFFEQVKKMLDANNMLNAGTQEESLTPQELVESKFHFAGGSSKFMFDLSTEEVIVMIDAIVERCEDLFKYV… |
| A0A1V9YUK4 | 221-377 | None |
| A0A081AZN0 | 115-294 | None |
| G4ZQY4 | 55-201 | None |
| A0A177WGX0 | 31-182 | None |
| A0A485KIV1 | 10-179 | None |
| A0A0W8CIC6 | 12-184 | None |
| A0A833WP42 | 80-271 | None |
| A0A329S023 | 2-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.