DPCstruct | MC21988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 187 ± 23 aa |
| Standard deviation of domain lengths | 23.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1IJE3 | 41-210 | EQRHGEADFKAKKRSLCSKLALEIFAERCLKTGYATVESTFIAKKYGVSSKTVRDIWNRRTWAEATKPLWTDEEKESTEELDACKER… |
| A0A7S0MMZ1 | 41-259 | GQGKSAFMFDLEHSAMQQPRKRAVLTVDQAAEIFNLRVPFCQATSSSARDRLFTSRSITVSRIYGVSPKAVRDIWNKRTWRHATRAL… |
| L1IFI5 | 45-193 | None |
| L1IUB3 | 41-208 | None |
| L1IQ37 | 1-184 | None |
| L1INT8 | 4-174 | None |
| L1IHM0 | 1-159 | None |
| L1I5A7 | 2-183 | None |
| A0A7S0EQ36 | 91-315 | None |
| L1JWM3 | 5-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.