DPCstruct | MC21986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 290 |
|---|---|
| Mean domain length (aa) | 399 ± 105 aa |
| Standard deviation of domain lengths | 104.87 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.31 |
| Pfam Score | 99.79 |
| Assigned Pfam label(s) | CL0617- CL0337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5B2K5 | 3-267 | VNWYGLLGKKFKDAFGHVGGAILGGMVGLKKPNNHGVPYSLTEEFVSVYRMHALLPDHLNLRDISAKPGPNKSPPLIRKIPMQNLIG… |
| A0A0U2KWQ1 | 33-380 | THQIDGSNIYGPDEAWRRKLRSLRNGKLRSRMVNGEEWPLSVAEVPVAMRRLPNQRDEDLFALGHEFYTFSPGLIMVSTIWLREHNR… |
| H9G386 | 80-447 | None |
| A0A2K6WMI1 | 845-1369 | None |
| A0A445D0Q0 | 109-535 | None |
| A0A226EKI3 | 532-1051 | None |
| A0A3B4V9D5 | 94-381 | None |
| A0A7R9A8L6 | 491-914 | None |
| A0A810LES0 | 23-362 | None |
| V4C5T3 | 65-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.