DPCstruct | MC21981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6CP27 | 176-275 | QPHVFIKCTPNNLDTCQLCEQKPLGDYWFKGNTILCRPCFGAQWKDETYFDRSQLLSLKKIRDCSHIHQHENTTAAYPLMEKKEVWK… |
| A0A0K8V9C8 | 1-105 | MKCFRCQEQPEGDYYHNFKSQLDICRRCLNKEVKELRHCKTDDYKRKLTLREWSEFKLVRHCSFYHLHKSGNMKSTLMTKSDLRKKI… |
| A0A482WRQ5 | 184-283 | None |
| A0A816X439 | 599-696 | None |
| A0A1D2N9P4 | 276-409 | None |
| A0A1A9UMZ3 | 105-211 | None |
| A0A6A4WUT3 | 183-279 | None |
| A0A6J2YKI0 | 6-98 | None |
| A0A0A9Z2G4 | 11-106 | None |
| A0A1A9ZD62 | 172-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.