DPCstruct | MC2198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 170 ± 33 aa |
| Standard deviation of domain lengths | 32.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.84 |
| Pfam Score | 52.75 |
| Assigned Pfam label(s) | CL0123- CL0036- CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6UBC9 | 39-196 | IDADVETDMYLYAVSYLKKHGFIQYEISNFAKPNAASLHNQMYWNYEDFCGIGCGASGKSGHIRYDNTRNLHTYLQKGSCPDIIELS… |
| R5JKY7 | 21-207 | LAENDRLLRLIPDEDTDRKMYEATERLLISGGYNRYEISNYARPGYECRHNIKYWTLKEYIGFGIGASSFFNQRRFSNTQDMDEYIR… |
| A0A5N4D6H7 | 165-346 | None |
| A0A4Y7JHW1 | 236-427 | None |
| A0A4Y9LFH0 | 3-121 | None |
| A0A6P5GHK0 | 243-476 | None |
| A0A3C0U4T7 | 53-235 | None |
| A0A7R9ZMU6 | 55-262 | None |
| A0A6G3VIY2 | 5-132 | None |
| U2SNY4 | 533-709 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.