DPCstruct | MC21977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 220 ± 40 aa |
| Standard deviation of domain lengths | 40.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 12.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0010- CL0320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3VC17 | 12-177 | VQPENALSVVQRVVSDKGWEDYALSEIQPVYTPFYVFTYDINTGEGVQSGRAALNGSTGELNEYVPLLLDKPVKRINSTPPDMSVDV… |
| A0A2H6GKQ1 | 12-208 | FLIKPKIRVKDTPPEITAIARQNHWKPPLIRSVIPFYYPFYRTRGQAMHWVTGEKRGDEVRRGETVEELKTRNFDLMRPGHTDLSTG… |
| A0A2R6C9U4 | 75-289 | None |
| A0A835XYQ7 | 67-319 | None |
| A0A7S1UMD8 | 3-262 | None |
| A0A800JEF7 | 7-210 | None |
| A0A497IAF8 | 18-193 | None |
| A0A0P7GK52 | 147-330 | None |
| A0A4E0Q3R3 | 198-372 | None |
| A0A1G5CS91 | 48-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.