DPCstruct | MC21975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 142 ± 26 aa |
| Standard deviation of domain lengths | 25.92 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0VQX6 | 280-462 | IPPDSMSIFATYVKTNNLVNDNLFSEILLYKLLSEEKQGFDKYFDVYPDLSSKIISNLYSYKSYNDFANTLKSKDITFSHLKRALCH… |
| A0A1V5KE60 | 23-158 | LSLPDAGEGLDRLLSRAARESGTLEELIGRVKSRRYTRARITRAVAHALGDLTAELAGAIGRPPYARLIGMRSGARPLMKELSGRAA… |
| A0A7X6T924 | 1-117 | None |
| R5KWT4 | 73-232 | None |
| A0A7Z0W2U8 | 2-128 | None |
| H1D9Q3 | 13-155 | None |
| A0A7C7D2C8 | 1-110 | None |
| A0A3D2IPL4 | 267-444 | None |
| A0A3C0NYG6 | 194-362 | None |
| R5L549 | 101-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.