DPCstruct | MC21974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 83 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832AEC6 | 18-94 | NIGSAVILPEVFLKALTIARNLGHTVEHFTTATFDMNRHYRPAENVVRRPTRKGGQGYYFVGHHELLVPLWAAAVIE |
| A0A1V5KDS5 | 10-93 | PEVFLKALSIARNLGYPTYDITTANFDLIDLGDYRRKLGYGDPQYYYRPRKNIVNRPVSRGGMGWHFTGDHQDTIPALYNLLTK |
| A0A3M2GBV9 | 243-306 | None |
| A0A7X0RNU5 | 556-655 | None |
| A0A0F9SLZ1 | 107-189 | None |
| A0A2H6HWW6 | 2-72 | None |
| A0A645BSN6 | 62-162 | None |
| A0A7X6Y3I8 | 42-133 | None |
| A0A7X9EBD9 | 1-76 | None |
| A0A1Q7ZUN7 | 3-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.