DPCstruct | MC21972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 140 ± 24 aa |
| Standard deviation of domain lengths | 23.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2DMR6 | 4-139 | QYPAPKGLPGAPFEDPNLKLAILSGLIDKQVVDLGTPRQLAEHVLGRPVDLEKEGYEQIPAVRAYLDRYPLTPDLLRQVDGLVLDGG… |
| A0A1M5R2B7 | 457-606 | FYSLNFKLVVFDNLLELGYFKTEWQNLKDKFYDNENYEYEPITELLDFCRYLEITDELLNEIKKIEFDGALDIYADLIPNWDGEDVT… |
| L1NMI0 | 108-254 | None |
| A0A554VRI9 | 86-219 | None |
| A0A553DRC5 | 4-153 | None |
| A0A561RHM9 | 5-146 | None |
| A0A653VXW4 | 126-258 | None |
| A0A5P9H6Y9 | 15-201 | None |
| A0A1I2IJ61 | 38-200 | None |
| A0A1G7RM18 | 247-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.