DPCstruct | MC2197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 326 ± 60 aa |
| Standard deviation of domain lengths | 60.08 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0Z624 | 40-404 | ILEEQHASRLKDLVPVRVGRMLQSPFAFYRGTAAVMAADLRSAPTTDLEVVSCGDAHISNFGFFASPERALVFDLNDFDEGGVAPWE… |
| A0A4Q7WZM5 | 24-295 | PEDLELKHRELAADPLRFLRGTYYLWLERVTELAPYVLDGPQVPAVGDLHVQNFGTWLDHRGVRRWGVNDLDELAWGSPALDLLRLA… |
| A0A815NFC5 | 1-284 | None |
| W7ZGQ0 | 138-432 | None |
| A0A3D2C1V6 | 190-651 | None |
| A0A7S2XPS5 | 150-544 | None |
| A0A813XKU9 | 7-326 | None |
| A0A2A2K255 | 3-229 | None |
| A0A0K2ZLC1 | 2-243 | None |
| A0A4R2WVP8 | 31-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.