DPCstruct | MC21969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446MU27 | 93-174 | WLDLDLPEDWVLLDCRFVYLGAGRFCITKIFEFGEDEDTGHPTEMGAVISGVEVVHSENTLQMVKHKSKFYNYVKDTIACVF |
| A0A453H0Y9 | 42-121 | WGDLSLPDDWEMMDCSMVYLGGGRFCVAKIFEFCLGDDRKGMGVISGLEVVRQGEPSKLVMVKHKSKLYKFTRGEIQCIL |
| A0A453SY97 | 1-80 | None |
| A0A0E0JVH3 | 168-237 | None |
| A0A0E0JT40 | 57-151 | None |
| A0A0E0MC15 | 106-191 | None |
| R7WGI7 | 185-268 | None |
| A0A835BV83 | 447-530 | None |
| A0A453H0Y3 | 114-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.