DPCstruct | MC21967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Standard deviation of domain lengths | 10.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 74.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8YJV3 | 1-65 | YRRKVFFNYEKRLRLRSPPEKVFEYFASFQTPEGELFMRPADLMRAVVPVFPPSESHLVRDGYLT |
| A0A7J9M2C7 | 17-105 | KLALLDNISKFIFREVYKRKVFFNYEKRLRLQSPPEKVSEYFASFQTPEGELFMRPVNLMRAVVVVFPPSESHLVRDGYLTGERKVK… |
| A0A2N9IAQ1 | 80-143 | None |
| A0A287U9G9 | 139-217 | None |
| A0A287U9C9 | 2-80 | None |
| A0A7J9L227 | 1-75 | None |
| A0A1U8NQN4 | 70-142 | None |
| A0A287U989 | 150-213 | None |
| A0A835Q2C3 | 3-67 | None |
| A0A4D9AHL8 | 96-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.