DPCstruct | MC21963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 84 ± 17 aa |
| Standard deviation of domain lengths | 16.55 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 92.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A858R9Z1 | 3-78 | PALLSAFRALTGLEAKPTYAAAHRWRYALPTAPLGSGYLLDWDLDLGACGDWCLEARGEAAWVSGHRLGQALAEAA |
| A0A1J5PUQ0 | 69-139 | AKLTKAFTEITGIRAEPALVQSKRWLYAKTLLPLGQSHLWDAKKGLGICGDWCLGHRVEDAFVSGLELALA |
| A0A7J9I3I0 | 1-106 | None |
| A0A7R9TZU2 | 5-91 | None |
| A0A2T4YLD4 | 1-68 | None |
| A0A849GNU8 | 48-123 | None |
| A0A845RVQ3 | 5-65 | None |
| A0A7S4DZU2 | 48-122 | None |
| A0A4U6P8E3 | 133-214 | None |
| A0A7S0RPY3 | 3-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.