DPCstruct | MC21962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 261 ± 31 aa |
| Standard deviation of domain lengths | 31.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5WYM7 | 1-212 | MTGHFETQFRPCLWAELDRARRTCGDLPAEARRAVAAAGTKALQAAARQFAEQQFGARPHQPLDIPASIQTAVAAALKPVASAEAVA… |
| A0A5B9QRU4 | 46-246 | RQKMEPFVQVEFSFANRICRLDADQQKKMAAALGKVLDKSAEEAAQFIPPNNANRAGAWMAQPQQANMKREALVEQIEQAIEPLLND… |
| A0A354PB47 | 64-328 | None |
| A0A354PAY5 | 1-247 | None |
| A0A353ZB64 | 204-459 | None |
| A0A7C7XR63 | 52-284 | None |
| A0A142WSZ5 | 96-397 | None |
| A0A142Y2S9 | 2-247 | None |
| A0A5C6C063 | 52-363 | None |
| A0A5B9QLW0 | 42-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.