DPCstruct | MC21958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D4DWP6 | 8-81 | TLSELQALHGRIFATLTAQEALVMDFYRRQGRKFDVVVGIINEADPIEVAAARTEAEADEIMKQANSRISVTIG |
| A0A3G7TPR5 | 2-75 | ESVEELKQLEGRQVAMLSQQEREVLRFFMDQGRKQGVLVRFESDADQQEWTETNSVRTLEILARANSYIHLQFC |
| A0A2V4ZPV1 | 4-82 | None |
| A0A2P8L6D3 | 70-156 | None |
| A0A2T5EJD8 | 1-91 | None |
| A0A5C9BQ57 | 28-115 | None |
| A0A7Y0WM20 | 3-104 | None |
| A0A7Y1ADF2 | 34-126 | None |
| A0A091B101 | 3-82 | None |
| U3LPF2 | 126-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.