DPCstruct | MC2195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1T396 | 1-114 | MEKYRFEVKVKSAEVPKSNIMCITSITEVDKETFLIPDKFQPVHFHETVMKTQAYQKVKATLQRRHGKRFVWIPISAEIKDLYMDQD… |
| A0A232EHP4 | 2-107 | DIKAKFFFVSETCTDSKSTVVKVKRIQLLGQEESFLFPVDKQTSAQHKQLYENSIVKNVVKSLKVRNKFRNVVLTLSEELKNIHLDT… |
| A0A4C1U3H2 | 1-111 | None |
| A0A6H5INV1 | 244-346 | None |
| A0A6H5I6P9 | 4-130 | None |
| A0A0L7K4E3 | 1-110 | None |
| J9KFL5 | 2-117 | None |
| A0A6H5HRD6 | 1-116 | None |
| A0A6H5HQP7 | 3-129 | None |
| T1FLR0 | 7-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.