DPCstruct | MC21949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 511 ± 102 aa |
| Standard deviation of domain lengths | 101.87 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.47 |
| Pfam Score | 92.00 |
| Assigned Pfam label(s) | CL0016- PF20163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q4BGF4 | 69-577 | QLQAAPTRKSIDTAHKAGKWLDIGIPSLRNLRYIGNWRRASWALLAISSIPVHLIYNSAVFKSLSSHNYTVAVVKDSFLDNSSWSLS… |
| U4KX37 | 118-681 | GIDGIGTVIEGSCSYVKSASIWIHFTINVLSKILLSSSNFTQQLDKILVSPSREDIDRAHSKGDWLDIGVPSICNMRRGMPWDRLIL… |
| S3BZN5 | 354-980 | None |
| A0A423VY50 | 180-555 | None |
| A0A370TEC1 | 79-657 | None |
| A0A4Q3P0A8 | 6-414 | None |
| X0GZJ7 | 17-412 | None |
| A0A2U3EB94 | 87-744 | None |
| A0A2J6Q4K5 | 28-460 | None |
| A0A364NDI7 | 38-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.