DPCstruct | MC21948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 89 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7WCC6 | 90-167 | HHHRRWCPVCLAEHGIWQTEWLLTLQIACPIHRLLLREKCPGCDKLIRWHQGTMFICSCGADLRHAATRPGTAAELAL |
| A0A6D0JF67 | 6-98 | PRNSRFGPGLQFCPYCLKSDPIPYFRLCWRVALQTFCEQHQCLLFDRCPSCGACLFVQRVDANLCHAEIDGICHCHNCDYDLRLAEA… |
| A0A132HAI9 | 55-131 | None |
| A0A2N1AP47 | 5-92 | None |
| Q21PC6 | 74-140 | None |
| A0A4S3K3G6 | 2-90 | None |
| A0A6N9HMN7 | 105-192 | None |
| A9BSY8 | 28-124 | None |
| A0A2U2AN65 | 25-137 | None |
| A0A0N7JWD0 | 54-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.