DPCstruct | MC21944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L3YDF0 | 77-189 | ITDVNASVDGTVANSGWRMTATVGSGGTSARISAYARINSGDAWKQAGWFINVTPTGSQFIVIANQFAIADPNNNGSYTYPFVVQNG… |
| A0A6D0J1X3 | 3-152 | KASYTLNLGIIRNGVKYNTGFGMSIEPSGGSYKSTVVFAADQFGIYSGSDPGNYEAAFFVYNGQVFIRDAMIQDGSITNAKIGSYIR… |
| A0A376F976 | 815-954 | None |
| A0A2W5C0J9 | 306-462 | None |
| A0A378BDB2 | 2-140 | None |
| A0A1N7GBD2 | 155-287 | None |
| A0A377D7V4 | 34-161 | None |
| A0A2A2H434 | 20-176 | None |
| A0A6D0USQ7 | 1-132 | None |
| A0A228IIU7 | 332-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.