DPCstruct | MC21942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 17 aa |
| Standard deviation of domain lengths | 17.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.15 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0123- CL0299 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A556RSQ7 | 3-80 | INFNSGGAKVLDRIIEAYGFKSKVEYSNYLGTSAASLSIRYRRDLFPSDLVVKCMDETGASLQWLATGEGQFNPADQT |
| A0A6D0J0W7 | 1-83 | MMLDSNFNNEALLNRICEVYGFTQKIQLANHFKIAASSLQNRYTRGNMSYDFAVHCALETGADLRWLMTGEGDKNLSSKEQNS |
| E0SAL5 | 211-317 | None |
| A0A3L7LSS9 | 1-79 | None |
| A0A0X8JK17 | 1-84 | None |
| A0A5D4LYQ3 | 1-94 | None |
| A0A7X5B082 | 1-115 | None |
| A0A447PAQ1 | 6-130 | None |
| A0A6N3IFW9 | 1-99 | None |
| G1V8Z5 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.