DPCstruct | MC21941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 15.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0JKS9 | 8-79 | QIKLQSVKLAMKYLKRVSSELEAIKGGPDEEELMLQGVRFAFRVHQFAGGFDVDTMRAFQELKEKASMCRIQ |
| A0A1J3ER30 | 7-101 | KRYTDFQIPWDWMLDAGLIGQVSDLMQLKYSSLRLAQAYMKRITNELESKGGGKEGNLMLQGVRFAYTIHQFVGGFDGETLHIFNEL… |
| A0A7N0TXJ2 | 19-120 | None |
| A0A6P6FXP6 | 329-419 | None |
| A0A0B2PC55 | 196-274 | None |
| D8R6B5 | 245-343 | None |
| C6JS82 | 205-327 | None |
| Q93ZL7 | 91-185 | None |
| A0A452ZZN6 | 7-115 | None |
| A0A2I0JI61 | 138-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.