DPCstruct | MC21939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 154 ± 19 aa |
| Standard deviation of domain lengths | 19.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8G8M6 | 11-148 | LQDFINVLKALEQYPIIGTIQVIMDVLPDGHGERRFTKLSDNVTKRRYVIAQMYLGNGKQFNIIEIERENRSLSMLILSSFEIREWK… |
| A0A6S4W6X2 | 135-291 | NYNSIFANRFAAFDELLSILKTKFACRVLFEETLVLPKVGRSRLHLCKDGSPRVIKAVGVQRNGSEFVLLEVDASDGVKMLSTKVLS… |
| A0A485B3I9 | 258-404 | None |
| A0A1E7YL12 | 11-158 | None |
| A0A7R7HN42 | 135-302 | None |
| A0A2T4DZ13 | 3-175 | None |
| A0A2P4RH68 | 7-196 | None |
| A0A072XA31 | 369-508 | None |
| A0A7H1MIT9 | 419-563 | None |
| A0A7U1GN44 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.