DPCstruct | MC21935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 297 ± 53 aa |
| Standard deviation of domain lengths | 53.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11991 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4UZW9 | 6-285 | GIDLEFFKHLKQDLTVDDQDSAYLLENNLVGGQIRTQNKLALDLKGGNFVLKTYIYPALKALATGKSIKTLMFDSVYRLCRQNPSLE… |
| A0A1L6M1R3 | 10-329 | EERAILDAFERVSHPWNRWPIGARPRWYPSILSDDHAPFELSAAFSAGETEIQWYWEAQGEPPSLESNMTTGLSVLQEVAEHYDLPL… |
| A0A2H4SQ07 | 2-384 | None |
| M1W0Y4 | 4-263 | None |
| A0A6G1M0X8 | 1-254 | None |
| A0A820WH30 | 63-438 | None |
| A0A511MYM3 | 10-230 | None |
| A0A524FJV1 | 119-380 | None |
| L7JEU3 | 23-402 | None |
| C4JZR2 | 35-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.