DPCstruct | MC21934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 337 ± 44 aa |
| Standard deviation of domain lengths | 43.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2JVA4 | 419-736 | GNREGVEHLLTYTSASSALHRALSAAAPGELRAVAAAWSRKAGLSIDWPGMNAELNALLQSSLAPWSGFYLDSSRRMSLSLFSRMKN… |
| A0A7D9JMM1 | 194-517 | NSNNAARAAAIELLTSNSFCKSYADEMKKYVHDPDLDTKLTAFLELHGFKTTPDAVQNALQELRESSLLPWRQVYHTSVGILEIRCK… |
| A0A0P7AQ33 | 1-404 | None |
| A0A066YLN8 | 385-680 | None |
| S3IW50 | 1-390 | None |
| A0A519H2S8 | 1-370 | None |
| T0KES9 | 6-418 | None |
| A8YDG8 | 305-596 | None |
| A0A2W4SPG2 | 4-302 | None |
| W1IMK7 | 574-903 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.