DPCstruct | MC21931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 16 aa |
| Standard deviation of domain lengths | 16.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1EB98 | 33-159 | IPPRPDRAPGGSQFWRDIVNTDESRRESAILEELRRGNLPESHRKMVRLDYKAESRSGHTHSVSLWVMPDYLAVGDDGDAMRVPMSP… |
| A0A813ZPV1 | 739-878 | KPNLALRARRQDEPVASGKQVSDIAPDGTNFGNSIMNVGPTQTREDLIFAQFQAGHIPDFMRNAIPVTVTAGIDTLTYWVLPDVLCI… |
| A0A6I1JTF3 | 4-106 | None |
| A0A2N2VU22 | 1-142 | None |
| A0A7X7IYJ7 | 239-363 | None |
| A0A2G6JQ82 | 11-155 | None |
| A0A4R2PUK2 | 211-371 | None |
| A0A844B6Q7 | 144-307 | None |
| A0A4R2NIC3 | 283-450 | None |
| A0A2N9NH10 | 101-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.