DPCstruct | MC21926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 49 ± 1 aa |
| Standard deviation of domain lengths | 1.28 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 93.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.99 |
| Mean intra-cluster sequence similarity (%) | 94.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446KWE8 | 83-132 | MLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSL |
| A0A3P5Z102 | 1-50 | MLFAGWFHYHKEAPKLAWFQDVESMLNHHLAGLLGLGSLSWEGHQVHVSL |
| A0A453ENV6 | 38-87 | None |
| A0A445BIP2 | 1-50 | None |
| A0A830CG46 | 51-96 | None |
| A0A830BVR4 | 1-50 | None |
| A0A830D2T2 | 46-93 | None |
| A0A452YKR5 | 1-50 | None |
| A0A5E4F8F7 | 456-505 | None |
| A0A0B2PS33 | 86-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.