DPCstruct | MC21923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 4.36 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 51.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11962 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316PSI3 | 243-314 | EDYDPSQSYIPRKDRPEWGYMGTHGELVVIDDGTCEAKGRCKPNDEAKATAAEDGFYVLERIDDNHIKIFVR |
| C1FPL1 | 1-84 | MNPVWDHTREFIPRCKRPEWVAVGLLGKILVRDDGTCQVNRYCRPNKEGIATASRYGYRVMKRIGENQVLVFFDHMRLGHLKNR |
| A0A316PE98 | 394-465 | None |
| A0A1V4W344 | 104-168 | None |
| A0A248TH06 | 719-794 | None |
| A0A5Q2NKX6 | 595-666 | None |
| A0A7H1VTN0 | 50-123 | None |
| A0A1G9QNR0 | 441-513 | None |
| G9QAB1 | 222-295 | None |
| A0A3E2NA39 | 313-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.