DPCstruct | MC2192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 160 ± 13 aa |
| Standard deviation of domain lengths | 13.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842YSB2 | 169-337 | RYVNSLLQDLHVIPAVRLSPMYNDEDNSLLRDLYSLLCHYAFFPIDDHTFAQCSQTEAYERHCAELRNLQRVAVRHFEEKLKLLALS… |
| A0A0D2M8G5 | 1-171 | MRLHPNSPRFRQLLDLASFYLDFPIDDHTGEPLKEDDVLGRHYEKVTQLQRLFFRHWPQLKDLALSNCAAVDKRDALRRELGALADD… |
| L8HF13 | 273-433 | None |
| A0A7R8CU34 | 13-175 | None |
| A0A7R9EK25 | 6-170 | None |
| A0A673Z151 | 130-274 | None |
| A0A6G3MGT6 | 16-175 | None |
| A0A6V7XCI8 | 159-340 | None |
| A0A433DN50 | 9-200 | None |
| A0A820AVL5 | 138-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.