DPCstruct | MC21918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 306 ± 55 aa |
| Standard deviation of domain lengths | 54.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | CL0238- CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9N6N5 | 2-270 | KKIFLLLPSSLLEDCSDLDAKTIKIGFIARAAAIFKVSEIIIYSTGETGAKSNGKFLKLIFDYIDCPQYLRKHLFPLSDELKSVGRL… |
| A0A6P6Y1V5 | 12-303 | WTVSIAVPSSIVDNAQSAELKSYLVGQIARSLVIFKIDEIIIYDEYCIPGTPEQVILDKRKESMVQAIRILEYLECPQYLRRQLFPI… |
| C1MZJ5 | 2-278 | None |
| M8AFH0 | 43-387 | None |
| A0A7R9KHG4 | 502-844 | None |
| A0A4S4DHB0 | 15-268 | None |
| A0A6J3G7H8 | 30-229 | None |
| A0A6A2XVA5 | 30-277 | None |
| A0A2K1QX16 | 282-616 | None |
| A0A4Q4ZRX8 | 29-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.