DPCstruct | MC21916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6YHC3 | 7-126 | FLHLLLIIINNVKTIILHDYDTVRFAYKPVYGLPKSLQCSESVYHKFNECEISSHREWKIWINEYFYETKEFCCFVWQAMACEIEIA… |
| A0A6P6XYY3 | 18-132 | FCYYFIQMIVANNVQDKKSLDNNMIPYKTVYGVPKRCIGRYDIQTTDDKYRICQINAIGKWQITFKHYYTESWNFCCFVYDVLECET… |
| A0A132AAB4 | 3-142 | None |
| A0A1Y3BI80 | 21-147 | None |
| A0A6P6YKN0 | 1-155 | None |
| A0A6P6YDY5 | 15-118 | None |
| A0A6P6Y8F8 | 37-128 | None |
| A0A6P6XV81 | 1-134 | None |
| A0A6P6XUG8 | 25-119 | None |
| A0A6P6XU07 | 23-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.