DPCstruct | MC21912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Standard deviation of domain lengths | 16.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A132AD98 | 6-90 | RNSIETRTLAGSFSTIGCLGTHDKAIFAELDRICSDCFMIYRDDDLHASCRENCFVNKVFGQCIDALMLSHEKKKLTESAYVLFG |
| A0A6P6XUY3 | 13-106 | LLVSFLLFMASFAINGSESRSFTILGCLGDYDLSKFAQLDRICDECYILYREPELNFSCRKDCFRNEVFGNCVDALYLSHEKKKLLQ… |
| A0A6L5CJY7 | 34-148 | None |
| A3RE86 | 12-119 | None |
| A0A835CMJ8 | 234-373 | None |
| A0A835CNU1 | 151-273 | None |
| A0A5B7DR08 | 70-211 | None |
| A0A182KA63 | 3-108 | None |
| D0EZP2 | 12-106 | None |
| A0A5N5SYD8 | 92-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.