DPCstruct | MC21909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 296 |
|---|---|
| Mean domain length (aa) | 185 ± 36 aa |
| Standard deviation of domain lengths | 36.32 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 97.39 |
| Assigned Pfam label(s) | PF12428- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RSF7 | 25-133 | GDLCRICQMSAVAPGNLLVVPCSCTGSLQYVHQDCMRRWLEAKIKSGAELSAVLHCELCKQLLRFEVEGFDIHQLYQEHSANQAQSD… |
| A0A6P6XM57 | 7-185 | KMISNNYSVGVGGGNHKKEKPICNICRQEESFKNLISPCDCKGTGGFVHFDCIKRWIETSGNDHCKACNVIYRKLKMRKKSGSFGKF… |
| A0A7S2SW95 | 2-181 | None |
| A0A6S7FEX8 | 207-408 | None |
| A0A7R9KCT9 | 4-148 | None |
| A0A0N0P944 | 1-301 | None |
| A0A1D2NJ48 | 324-490 | None |
| A0A7R9NWQ4 | 613-792 | None |
| A0A5P1FM83 | 796-983 | None |
| A0A2C9JXR9 | 276-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.