DPCstruct | MC21906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8IS59 | 1-98 | MEWISFENRTTIGQTGSESGVIVRDSEHPLGARITLEKDGSVAPYSITCGIYGCMVHTRFFSAEQEASQQFDLMAAELESILKDSGS… |
| A0A7T9CLC3 | 15-123 | PWVRLDDGATLGQRGSEGGVILLDDEHPAGARITLEATGYPPFAITCGVYGSMVHTRFLGTEEGARREVEAMKPRLALLAASVPYVD… |
| A0A7W9SN49 | 12-124 | None |
| A0A6N8C1U1 | 9-88 | None |
| A0A1M6SHB6 | 54-148 | None |
| A0A0F9EJR4 | 1-112 | None |
| A0A316N2D6 | 3-115 | None |
| A0A6I2H0H4 | 9-122 | None |
| A0A387GNE0 | 1-82 | None |
| A0A1G9P0N6 | 105-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.