DPCstruct | MC21902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 147 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A227LQ13 | 1-155 | MKIEEGSIFCIPLFMDKNDWELKLKLSEKDLEKDFAFGRVIETSSSVLVEIFNKIGPAYTDINEIVNSGIMFSPVQIFWDAIPKKRW… |
| A0A2V2S8X3 | 2-143 | KLEIEPGLVFAIRLLNGAYGFGQLLVRQEPIFYMAGYDAQSQTPTLGHDTIWKAKPVLLGNFFDVLIRNGRWAPVGHSTPPVVPYPC… |
| A0A350IGC9 | 2-162 | None |
| A0A3B0BV99 | 4-150 | None |
| A0A250JA78 | 75-221 | None |
| A0A5J6ST49 | 40-174 | None |
| A0A1Q9C235 | 680-812 | None |
| A0A4R0ZA78 | 2-150 | None |
| A0A357ZE90 | 37-198 | None |
| A0A015V7A1 | 6-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.