DPCstruct | MC21901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 153 ± 19 aa |
| Standard deviation of domain lengths | 18.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368TML0 | 1-133 | MGSEVITGGDLLIASGQDQTYQAARLDAGDDIELQSGGTIRFETTSDVHTESHERSKSSFAWQSSSGEGFTRETLRQSELVAQGDLI… |
| E2XZX6 | 40-175 | TEIKTGSDLTLKSAGDQTYQLAKLQSGKNIVLDSGGAITFEAVKDLHQESHEKSNNNAFWVSSKGKGNTDETVRQSQLIAEGNVAIK… |
| A0A837Q4P7 | 43-219 | None |
| A0A3M6GY93 | 310-440 | None |
| N1NIC9 | 385-552 | None |
| A0A6I6SD32 | 77-208 | None |
| A0A3D9UDC5 | 292-470 | None |
| A0A0G4BXX7 | 177-350 | None |
| A0A1N7USH6 | 220-351 | None |
| A0A378PMK5 | 290-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.