DPCstruct | MC2190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 20.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P22902 | 5-122 | MIDALNIATMPIADKVHRHMLASYYALQLDALQAEAKRLGYFFAQADTAATMPPVLADCLAWAVEYRRRCYLYPNCPESWERHTADS… |
| A0A212BGW0 | 1-140 | MNLPVNIADLAIADRVNRRVNSYFFANHLKVIQKVAAESGYRFVQCPPEEEIGRLPADLERAMEEGLAKARADYTLKKASAEQKQRW… |
| A0A7U4Q3C9 | 1-114 | None |
| A0A2P8L6A5 | 79-194 | None |
| A0A6H3AQW8 | 16-135 | None |
| A0A0T9R1Q8 | 152-275 | None |
| A0A0A3Z3W0 | 17-129 | None |
| E3HY76 | 257-365 | None |
| A0A3A3Z845 | 63-176 | None |
| A0A5J6W9K2 | 67-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.