DPCstruct | MC219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 139 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 87.40 |
| Assigned Pfam label(s) | PF04239- CL0177- PF20730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564SFL7 | 8-153 | VAIKLALGLLSLVFVINVSGKGNLAPNSASDQVQNYVLGGIIGGVIYNPAITILQYCVILLIWMILVLSLKWLKTNNHFVKRVIDGK… |
| L1QKG3 | 24-189 | VLIRTAILYFLVILVMRLMGKRQIGELQPYEFVITIMISDLAALPMQDTRLPLILGIIPIVTLLFIKTILTQLQLKSQFARKFLEGE… |
| A0A7C6VCY3 | 21-177 | None |
| A0A6J4KEA1 | 81-231 | None |
| A0A1Y2T5M6 | 23-177 | None |
| T2RFY6 | 1-132 | None |
| A0A1Q6RBP6 | 2-158 | None |
| A0A521BB02 | 27-174 | None |
| A0A2N6RNV1 | 6-132 | None |
| A0A7W0QCH9 | 6-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.