DPCstruct | MC21896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 240 ± 26 aa |
| Standard deviation of domain lengths | 26.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1MV29 | 14-260 | SGIHKKYHDIMMQNELQGGYKGYELSWAGPGKSAPSFGGNQMDIGGNQHARDTLKDIIKNAVNEKGESFFIKSELDYITTILKDKNS… |
| A0A528WIF1 | 3-214 | EARLIAAISAALRMHEIGTKSPYQLYFAAKGKSGGSFGFMQGDLAAGQDIVTKTFRQILADADASKADIQRYLDKLSVHLIGNPLSS… |
| J5MVC2 | 34-289 | None |
| A0A154TNI6 | 10-258 | None |
| A0A7J4W1F2 | 60-336 | None |
| F0BJF7 | 1-269 | None |
| A0A2V3PYF1 | 3-210 | None |
| D7N1U8 | 31-278 | None |
| A0A5C8DGE4 | 234-484 | None |
| A0A1H5BAF0 | 20-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.