DPCstruct | MC21894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 100 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N0LR41 | 1-104 | MEYKLNKGVGQDVEFCGLKAQYLYLFAGGLLAVFLVFVILYMAGVNRWFCIALCVVSATGITLGVFRLNRKYGPHGLMKLAAAGYRP… |
| A0A364XXX7 | 4-102 | TVYTINKGINRPVVFKGLKAQYIVYVAIGVLSLLVLFAVLYIIGTNMFLCIAIVAILGVLLFVMVYRISDKYGQYGLMKRRAYGRIP… |
| A0A1Q3TD79 | 1-105 | None |
| A0A1T4NX44 | 1-97 | None |
| Q8A4J5 | 132-227 | None |
| A0A4Q5TVM9 | 43-144 | None |
| A0A7L5DYL0 | 1-105 | None |
| A0A4R8C919 | 1-93 | None |
| A0A1G8NMK8 | 54-150 | None |
| A0A1H7B8F7 | 238-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.