DPCstruct | MC21886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 135 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 75.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4UCH2 | 72-211 | LDNRAIYTQTDRAGAQWSFNGSAWTREGKADTTNDGVDNPTSTPIVASYEKARELNYQATNAAAALALKDAPAPQDPYRQPANATDR… |
| A0A109HEQ3 | 3-137 | DNRAIYHQTDRDGRHWSFDGRAWSREGMADTTNDGVNNPTLTPIVANYDKARELNYLATNAAAALALKDAPQPDDPYSLPADDRDRP… |
| A0A5A7VN74 | 226-352 | None |
| A0A6P1LDC1 | 414-549 | None |
| A0A1I0PDX1 | 286-422 | None |
| A0A2U9T8K8 | 191-339 | None |
| A0A3M2HQ25 | 50-190 | None |
| A0A6P1LC64 | 278-410 | None |
| A0A854HCI4 | 417-549 | None |
| A0A1T5DIF7 | 287-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.