DPCstruct | MC2188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401X0M0 | 1-86 | MIPAGIETVYIHSNTSRRNEAIGPFVDDRRTLGVLVGNASICHGNTTRTLTSYLHDEDLAGWNNVEFYPMRWTAGNACLWATENRE |
| A0A847KXM9 | 88-171 | IPVGVQSVRIISNSSRPSDVIGPFVDDRRNLGILVGEIKMFESRATRTLTSHLRDEELVGWNNVEDGTMRWTTGDAVLPLGNRP |
| A0A1Y3G1C5 | 632-715 | None |
| A0A251ZV93 | 44-145 | None |
| A0A6N3TAG4 | 597-697 | None |
| G6F0K2 | 184-269 | None |
| F7VDX0 | 61-163 | None |
| A0A433WZH7 | 355-455 | None |
| A0A6S6PNN7 | 225-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.