DPCstruct | MC21879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 51.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256BN35 | 39-115 | MVGSDGWCINFDHLNRNCKIYDQRPRFCRVEPDTFYDMFGVEPEELDDFAIACCEENIESIYGDRSLELLRFEKAIS |
| A0A4D9CSB2 | 1-76 | MVGDDGWCIHYDKAARACTVFEDRPWFCRVEGKTFEKMYGVTGSEMDKFCTSCCREQIADVYGTTSGEMRSFNMAI |
| A0A7G8HAR5 | 12-86 | None |
| W7TMW6 | 181-269 | None |
| A0A3S3NTC0 | 113-192 | None |
| D8LKL6 | 170-245 | None |
| A0A0D6AGS6 | 64-151 | None |
| A0A7N0U4H6 | 105-183 | None |
| A0A4S4EVW5 | 87-164 | None |
| A0A0A9PJR1 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.