DPCstruct | MC21874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 326 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2G6B9 | 47-345 | SDVKDIEYVLYLDTNIYQFLLSSYRKISNEITRDAISLLVFCQLSKIEIDPVYAIYEKINYTNEKVDETIEELKLFYQINNSNIYSL… |
| A0A0X8FB91 | 65-382 | KILDKEYVKSSYILSLDSNVLGDLKNCFVKENENSDLLSMIALAKKNNMRLDFNPYVLENTLNNYYFEDEILYKHIEAFNTADSFDP… |
| A0A147EYV2 | 2-306 | None |
| A0A430KLZ2 | 1-358 | None |
| A0A3C1DKD3 | 134-484 | None |
| A0A1M6UYQ7 | 9-341 | None |
| A0A5P1UX42 | 67-401 | None |
| A0A286FTG4 | 265-581 | None |
| W4ADH9 | 2-316 | None |
| A0A7K3VNT4 | 1-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.